Purified Membrane Proteins

Coiled-coil domain-containing protein 167

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CC167_HUMAN

Gene Name:

CCDC167 C6orf129 HSPC265

Uniprot Accession:

Q9P0B6

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

97

AA

Mass:

11459

Da

MTKKKRENLGVALEIDGLEEKLSQCRRDLEAVNSRLHSRELSPEARRSLEKEKNSLMNKASNYEKELKFLRQENRKNMLLSVAIFILLTLVYAYWTM

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes