Purified Membrane Proteins

DOMON domain-containing protein FRRS1L (Brain protein CG-6) (Ferric-chelate reductase 1-like protein)

Important modulator of glutamate signaling pathway. {ECO:0000269|PubMed:27236917}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

FRS1L_HUMAN

Gene Name:

FRRS1L C9orf4

Uniprot Accession:

Q9P0K9

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

293

AA

Mass:

32389

Da

MARPPRQHPGVWASLLLLLLTGPAACAASPADDGAGPGGRGPRGRARGDTGADEAVPRHDSSYGTFAGEFYDLRYLSEEGYPFPTAPPVDPFAKIKVDDCGKTKGCFRYGKPGCNAETCDYFLSYRMIGADVEFELSADTDGWVAVGFSSDKKMGGDDVMACVHDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVPRDETIVDLHLSWYYLFAWGPAIQGSITRHDIDSPPASERVVSIYKYEDIFMPSAAYQTFSSPFCLLLIVALTFYLLMGTP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes