Purified Membrane Proteins

Transmembrane protein 14C

Required for normal heme biosynthesis. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM14C_HUMAN

Gene Name:

TMEM14C C6orf53 HSPC194

Uniprot Accession:

Q9P0S9

Origin:

Homo sapiens (Human)

Protein family:

TMEM14 family

Full-length:

112

AA

Mass:

11565

Da

MQDTGSVVPLHWFGFGYAALVASGGIIGYVKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNVWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLLMVAKVGVSMFNRPH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes