Purified Membrane Proteins

Mitochondrial import receptor subunit TOM7 homolog (Translocase of outer membrane 7 kDa subunit homolog)

Required for assembly and stability of the TOM complex. Positive regulator of PRKN translocation to damaged mitochondria. Acts probably by stabilizing PINK1 on the outer membrane of depolarized mitochondria. {ECO:0000269|PubMed:18331822, ECO:0000269|PubMed:24270810}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TOM7_HUMAN

Gene Name:

TOMM7 TOM7 TOMM07 AD-014

Uniprot Accession:

Q9P0U1

Origin:

Homo sapiens (Human)

Protein family:

Tom7 family

Full-length:

55

AA

Mass:

6248

Da

MVKLSKEAKQRLQQLFKGSQFAIRWGFIPLVIYLGFKRGADPGMPEPTVLSLLWG

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes