Purified Membrane Proteins

Dolichol-phosphate mannosyltransferase subunit 3 (Dolichol-phosphate mannose synthase subunit 3) (DPM synthase subunit 3) (Dolichyl-phosphate beta-D-mannosyltransferase subunit 3) (Mannose-P-dolichol synthase subunit 3) (MPD synthase subunit 3) (Prostin-1)

Stabilizer subunit of the dolichol-phosphate mannose (DPM) synthase complex; tethers catalytic subunit DPM1 to the endoplasmic reticulum. {ECO:0000269|PubMed:10835346}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

DPM3_HUMAN

Gene Name:

DPM3

Uniprot Accession:

Q9P2X0

Origin:

Homo sapiens (Human)

Protein family:

DPM3 family

Full-length:

92

AA

Mass:

10094

Da

MTKLAQWLWGLAILGSTWVALTTGALGLELPLSCQEVLWPLPAYLLVSAGCYALGTVGYRVATFHDCEDAARELQSQIQEARADLARRGLRF

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes