Purified Membrane Proteins

Stomatin-like protein 1 (SLP-1) (EPB72-like protein 1) (Protein unc-24 homolog) (Stomatin-related protein) (STORP)

May play a role in cholesterol transfer to late endosomes (PubMed:19696025). May play a role in modulating membrane acid-sensing ion channels. Can specifically inhibit proton-gated current of ASIC1 isoform 1. Can increase inactivation speed of ASIC3. May be involved in regulation of proton sensing in dorsal root ganglions (By similarity). May play a role in protecting FBXW7 isoform 3 from degradation (PubMed:23082202). {ECO:0000250|UniProtKB:Q8CI66, ECO:0000269|PubMed:19696025, ECO:0000305|PubMed:23082202}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

STML1_HUMAN

Gene Name:

STOML1 SLP1 UNC24 MSTP019

Uniprot Accession:

Q9UBI4

Origin:

Homo sapiens (Human)

Protein family:

Band 7/mec-2 family

Full-length:

398

AA

Mass:

42968

Da

MLGRSGYRALPLGDFDRFQQSSFGFLGSQKGCLSPERGGVGTGADVPQSWPSCLCHGLISFLGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKISDQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMAGGAPSPGPADTVEMVSEVEPPAPQVGARSSPKQPLAEGLLTALQPFLSEALVSQVGACYQFNVVLPSGTQSAYFLDLTTGRGRVGHGVPDGIPDVVVEMAEADLRALLCRELRPLGAYMSGRLKVKGDLAMAMKLEAVLRALK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes