Purified Membrane Proteins

Chemokine-like factor (C32)

May play an important role in inflammation and regeneration of skeletal muscle (PubMed:11415443). Essential for embryonic development (By similarity). {ECO:0000250|UniProtKB:Q9DAS1, ECO:0000269|PubMed:11415443}.; [Isoform 1]: Has chemotactic response in monocytes, neutrophils and lymphocytes (PubMed:11415443). Binds CCR4 (PubMed:16137713). {ECO:0000269|PubMed:11415443, ECO:0000269|PubMed:16137713}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CKLF_HUMAN

Gene Name:

CKLF CKLF1 HSPC224 UNQ410/PRO772

Uniprot Accession:

Q9UBR5

Origin:

Homo sapiens (Human)

Protein family:

Chemokine-like factor family

Full-length:

152

AA

Mass:

17170

Da

MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITGFEVTVILFFILLYVLRLDRLMKWLFWPLLDIINSLVTTVFMLIVSVLALIPETTTLTVGGGVFALVTAVCCLADGALIYRKLLFNPSGPYQKKPVHEKKEVL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes