Purified Membrane Proteins

Mitochondrial dicarboxylate carrier (DIC) (Solute carrier family 25 member 10)

Catalyzes the electroneutral exchange or flux of physiologically important metabolites such as dicarboxylates (malonate, malate, succinate), inorganic sulfur-containing anions, and phosphate, across mitochondrial inner membrane (PubMed:29211846). Plays an important role in gluconeogenesis, fatty acid metabolism, urea synthesis, and sulfur metabolism, particularly in liver, by supplying the substrates for the different metabolic processes. Regulates fatty acid release from adipocytes, and contributes to systemic insulin sensitivity (By similarity). {ECO:0000250|UniProtKB:Q9QZD8, ECO:0000269|PubMed:29211846}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

DIC_HUMAN

Gene Name:

SLC25A10 DIC

Uniprot Accession:

Q9UBX3

Origin:

Homo sapiens (Human)

Protein family:

Mitochondrial carrier (TC 2.A.29) family

Full-length:

287

AA

Mass:

31282

Da

MAAEARVSRWYFGGLASCGAACCTHPLDLLKVHLQTQQEVKLRMTGMALRVVRTDGILALYSGLSASLCRQMTYSLTRFAIYETVRDRVAKGSQGPLPFHEKVLLGSVSGLAGGFVGTPADLVNVRMQNDVKLPQGQRRNYAHALDGLYRVAREEGLRRLFSGATMASSRGALVTVGQLSCYDQAKQLVLSTGYLSDNIFTHFVASFIAGGCATFLCQPLDVLKTRLMNSKGEYQGVFHCAVETAKLGPLAFYKGLVPAGIRLIPHTVLTFVFLEQLRKNFGIKVPS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes