Purified Membrane Proteins

Transmembrane protein 59-like (Brain-specific membrane-anchored protein)

Modulates the O-glycosylation and complex N-glycosylation steps occurring during the Golgi maturation of APP. Inhibits APP transport to the cell surface and further shedding. {ECO:0000269|PubMed:20427278}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM59L_HUMAN

Gene Name:

TMEM59L BSMAP C19orf4

Uniprot Accession:

Q9UK28

Origin:

Homo sapiens (Human)

Protein family:

TMEM59 family

Full-length:

342

AA

Mass:

37619

Da

MAAVALMPPPLLLLLLLASPPAASAPSARDPFAPQLGDTQNCQLRCRDRDLGPQPSQAGLEGASESPYDRAVLISACERGCRLFSICRFVARSSKPNATQTECEAACVEAYVKEAEQQACSHGCWSQPAEPEPEQKRKVLEAPSGALSLLDLFSTLCNDLVNSAQGFVSSTWTYYLQTDNGKVVVFQTQPIVESLGFQGGRLQRVEVTWRGSHPEALEVHVDPVGPLDKVRKAKIRVKTSSKAKVESEEPQDNDFLSCMSRRSGLPRWILACCLFLSVLVMLWLSCSTLVTAPGQHLKFQPLTLEQHKGFMMEPDWPLYPPPSHACEDSLPPYKLKLDLTKL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes