Purified Membrane Proteins

Tetraspanin-16 (Tspan-16) (Tetraspanin TM4-B) (Transmembrane 4 superfamily member 16)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TSN16_HUMAN

Gene Name:

TSPAN16 TM4SF16

Uniprot Accession:

Q9UKR8

Origin:

Homo sapiens (Human)

Protein family:

Tetraspanin (TM4SF) family

Full-length:

245

AA

Mass:

26266

Da

MAEIHTPYSSLKKLLSLLNGFVAVSGIILVGLGIGGKCGGASLTNVLGLSSAYLLHVGNLCLVMGCITVLLGCAGWYGATKESRGTLLFCILSMVIVLIMEVTAATVVLLFFPIVGDVALEHTFVTLRKNYRGYNEPDDYSTQWNLVMEKLKCCGVNNYTDFSGSSFEMTTGHTYPRSCCKSIGSVSCDGRDVSPNVIHQKGCFHKLLKITKTQSFTLSGSSLGAAVIQRWGSRYVAQAGLELLA

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes