Purified Membrane Proteins

Olfactory receptor 2W1 (Hs6M1-15) (Olfactory receptor OR6-13)

Odorant receptor. {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

OR2W1_HUMAN

Gene Name:

OR2W1

Uniprot Accession:

Q9Y3N9

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family

Full-length:

320

AA

Mass:

36101

Da

MDQSNYSSLHGFILLGFSNHPKMEMILSGVVAIFYLITLVGNTAIILASLLDSQLHTPMYFFLRNLSFLDLCFTTSIIPQMLVNLWGPDKTISYVGCIIQLYVYMWLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLTLNLPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVLTPLILILISYGYIAKAVLRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSLNPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKS

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes