Purified Membrane Proteins

Transmembrane protein 184B (Putative MAPK-activating protein FM08)

May activate the MAP kinase signaling pathway. {ECO:0000269|PubMed:12761501}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T184B_HUMAN

Gene Name:

TMEM184B C22orf5 PSEC0108

Uniprot Accession:

Q9Y519

Origin:

Homo sapiens (Human)

Protein family:

TMEM184 family

Full-length:

407

AA

Mass:

45562

Da

MTVRGDVLAPDPASPTTAAASPSVSVIPEGSPTAMEQPVFLMTTAAQAISGFFVWTALLITCHQIYMHLRCYSCPNEQRYIVRILFIVPIYAFDSWLSLLFFTNDQYYVYFGTVRDCYEALVIYNFLSLCYEYLGGESSIMSEIRGKPIESSCMYGTCCLWGKTYSIGFLRFCKQATLQFCVVKPLMAVSTVVLQAFGKYRDGDFDVTSGYLYVTIIYNISVSLALYALFLFYFATRELLSPYSPVLKFFMVKSVIFLSFWQGMLLAILEKCGAIPKIHSARVSVGEGTVAAGYQDFIICVEMFFAALALRHAFTYKVYADKRLDAQGRCAPMKSISSSLKETMNPHDIVQDAIHNFSPAYQQYTQQSTLEPGPTWRGGAHGLSRSHSLSGARDNEKTLLLSSDDEF

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes