Purified Membrane Proteins

Tetraspanin-11 (Tspan-11)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TSN11_HUMAN

Gene Name:

TSPAN11

Uniprot Accession:

A1L157

Origin:

Homo sapiens (Human)

Protein family:

Tetraspanin (TM4SF) family

Full-length:

253

AA

Mass:

28245

Da

MAHYKTEQDDWLIIYLKYLLFVFNFFFWVGGAAVLAVGIWTLVEKSGYLSVLASSTFAASAYILIFAGVLVMVTGFLGFGAILWERKGCLSTYFCLLLVIFLVELVAGVLAHVYYQRLSDELKQHLNRTLAENYGQPGATQITASVDRLQQDFKCCGSNSSADWQHSTYILLREAEGRQVPDSCCKTVVVRCGQRAHPSNIYKVEGGCLTKLEQFLADHLLLMGAVGIGVACLQICGMVLTCCLHQRLQRHFY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes