Purified Membrane Proteins

Small integral membrane protein 30

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SIM30_HUMAN

Gene Name:

SMIM30

Uniprot Accession:

A4D0T7

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

59

AA

Mass:

6102

Da

MTSVSTQLSLVLMSLLLVLPVVEAVEAGDAIALLLGVVLSITGICACLGVYARKRNGQM

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes