Purified Membrane Proteins

Transmembrane protein 14DP

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM14D_HUMAN

Gene Name:

TMEM14DP TMEM14D

Uniprot Accession:

A8MWL7

Origin:

Homo sapiens (Human)

Protein family:

TMEM14 family

Full-length:

114

AA

Mass:

12177

Da

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGRAPSLAAGLLFGSLAGVGAYQLYQDPRNVWDFLAATSVTFVGIMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes