Purified Membrane Proteins

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6 (Complex I-B17) (CI-B17) (NADH-ubiquinone oxidoreductase B17 subunit)

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. {ECO:0000269|PubMed:27626371}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NDUB6_HUMAN

Gene Name:

NDUFB6

Uniprot Accession:

O95139

Origin:

Homo sapiens (Human)

Protein family:

Complex I NDUFB6 subunit family

Full-length:

128

AA

Mass:

15489

Da

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes