Purified Membrane Proteins

Vesicle-associated membrane protein 5 (VAMP-5) (Myobrevin)

May participate in trafficking events that are associated with myogenesis, such as myoblast fusion and/or GLUT4 trafficking.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

VAMP5_HUMAN

Gene Name:

VAMP5 HSPC191

Uniprot Accession:

O95183

Origin:

Homo sapiens (Human)

Protein family:

Synaptobrevin family

Full-length:

116

AA

Mass:

12805

Da

MAGIELERCQQQANEVTEIMRNNFGKVLERGVKLAELQQRSDQLLDMSSTFNKTTQNLAQKKCWENIRYRICVGLVVVGVLLIILIVLLVVFLPQSSDSSSAPRTQDAGIASGPGN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes