Purified Membrane Proteins

Neurotensin receptor type 2 (NT-R-2) (NTR2) (Levocabastine-sensitive neurotensin receptor)

Receptor for the tridecapeptide neurotensin. It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NTR2_HUMAN

Gene Name:

NTSR2

Uniprot Accession:

O95665

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family, Neurotensin receptor subfamily, NTSR2 sub-subfamily

Full-length:

410

AA

Mass:

45385

Da

METSSPRPPRPSSNPGLSLDARLGVDTRLWAKVLFTALYALIWALGAAGNALSAHVVLKARAGRAGRLRHHVLSLALAGLLLLLVGVPVELYSFVWFHYPWVFGDLGCRGYYFVHELCAYATVLSVAGLSAERCLAVCQPLRARSLLTPRRTRWLVALSWAASLGLALPMAVIMGQKHELETADGEPEPASRVCTVLVSRTALQVFIQVNVLVSFVLPLALTAFLNGVTVSHLLALCSQVPSTSTPGSSTPSRLELLSEEGLLSFIVWKKTFIQGGQVSLVRHKDVRRIRSLQRSVQVLRAIVVMYVICWLPYHARRLMYCYVPDDAWTDPLYNFYHYFYMVTNTLFYVSSAVTPLLYNAVSSSFRKLFLEAVSSLCGEHHPMKRLPPKPQSPTLMDTASGFGDPPETRT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes