Purified Membrane Proteins

Tumor necrosis factor ligand superfamily member 9 (4-1BB ligand) (4-1BBL)

Cytokine that binds to TNFRSF9. Induces the proliferation of activated peripheral blood T-cells. May have a role in activation-induced cell death (AICD). May play a role in cognate interactions between T-cells and B-cells/macrophages. {ECO:0000269|PubMed:20032458}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TNFL9_HUMAN

Gene Name:

TNFSF9

Uniprot Accession:

P41273

Origin:

Homo sapiens (Human)

Protein family:

Tumor necrosis factor family

Full-length:

254

AA

Mass:

26625

Da

MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes