Purified Membrane Proteins

G-protein coupled receptor 15 (Brother of Bonzo) (BoB)

Probable chemokine receptor. Alternative coreceptor with CD4 for HIV-1 infection.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

GPR15_HUMAN

Gene Name:

GPR15

Uniprot Accession:

P49685

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family

Full-length:

360

AA

Mass:

40787

Da

MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHFKPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCSVLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDKPYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSIKIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPFIYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes