Purified Membrane Proteins

Fms-related tyrosine kinase 3 ligand (Flt3 ligand) (Flt3L) (SL cytokine)

Stimulates the proliferation of early hematopoietic cells by activating FLT3. Synergizes well with a number of other colony stimulating factors and interleukins.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

FLT3L_HUMAN

Gene Name:

FLT3LG

Uniprot Accession:

P49771

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

235

AA

Mass:

26416

Da

MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPTAPQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes