Purified Membrane Proteins

Pituitary tumor-transforming gene 1 protein-interacting protein (Pituitary tumor-transforming gene protein-binding factor) (PBF) (PTTG-binding factor)

May facilitate PTTG1 nuclear translocation.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

PTTG_HUMAN

Gene Name:

PTTG1IP C21orf1 C21orf3

Uniprot Accession:

P53801

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

180

AA

Mass:

20324

Da

MAPGVARGPTPYWRLRLGGAALLLLLIPVAAAQEPPGAACSQNTNKTCEECLKNVSCLWCNTNKACLDYPVTSVLPPASLCKLSSARWGVCWVNFEALIITMSVVGGTLLLGIAICCCCCCRRKRSRKPDRSEEKAMREREERRIRQEERRAEMKTRHDEIRKKYGLFKEENPYARFENN

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes