Purified Membrane Proteins

Protein BEAN1 (Brain-expressed protein associating with Nedd4 homolog) (BEAN)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

BEAN1_HUMAN

Gene Name:

BEAN1

Uniprot Accession:

Q3B7T3

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

259

AA

Mass:

28626

Da

MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRQARLQRHRHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDWPPPLDISSDGDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDGTSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPDPGPRGSQGSPTPTRAPASGPERIV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes