Purified Membrane Proteins

Noncompact myelin-associated protein (Myelin protein of 11 kDa) (MP11)

Plays a role in myelin formation. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NCMAP_HUMAN

Gene Name:

NCMAP C1orf130

Uniprot Accession:

Q5T1S8

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

102

AA

Mass:

11082

Da

MTTATPLGDTTFFSLNMTTRGEDFLYKSSGAIVAAVVVVVIIIFTVVLILLKMYNRKMRTRRELEPKGPKPTAPSAVGPNSNGSQHPATVTFSPVDVQVETR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes