Purified Membrane Proteins

Transmembrane protein 273

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM273_HUMAN

Gene Name:

TMEM273 C10orf128

Uniprot Accession:

Q5T292

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

105

AA

Mass:

11325

Da

MNLGVSMLRILFLLDVGGAQVLATGKTPGAEIDFKYALIGTAVGVAISAGFLALKICMIRRHLFDDDSSDLKSTPGGLSDTIPLKKRAPRRNHNFSKRDAQVIEL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes