Purified Membrane Proteins

STEAP family member 1B

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

STEAL_HUMAN

Gene Name:

STEAP1B

Uniprot Accession:

Q6NZ63

Origin:

Homo sapiens (Human)

Protein family:

STEAP family

Full-length:

245

AA

Mass:

28815

Da

MESRKDITNQEEIWKMKPRRNLEDNDYLQTAHADEFDCPSELQHAQELFPQWHLPIKIAAVMASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQVHNGTKYKKFPHWLDKWMLTRKQFGLLSLFFAVLHAIYTLSYAMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQVHGRINFLTL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes