Purified Membrane Proteins

Transmembrane protein 91 (Dispanin subfamily C member 3) (DSPC3)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TMM91_HUMAN

Gene Name:

TMEM91

Uniprot Accession:

Q6ZNR0

Origin:

Homo sapiens (Human)

Protein family:

CD225/Dispanin family

Full-length:

172

AA

Mass:

18162

Da

MDSPSLRELQQPLLEGTECETPAQKPGRHELGSPLREIAFAESLRGLQFLSPPLPSVSAGLGEPRPPDVEDMSSSDSDSDWDGGSRLSPFLPHDHLGLAVFSMLCCFWPVGIAAFCLAQKTNKAWAKGDIQGAGAASRRAFLLGVLAVGLGVCTYAAALVTLAAYLASRDPP

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes