Purified Membrane Proteins

Putative thiamine transporter SLC35F3 (Solute carrier family 35 member F3)

May be a thiamine transporter. {ECO:0000303|PubMed:24509276}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S35F3_HUMAN

Gene Name:

SLC35F3

Uniprot Accession:

Q8IY50

Origin:

Homo sapiens (Human)

Protein family:

SLC35F solute transporter family

Full-length:

421

AA

Mass:

46817

Da

MKKHSARVAPLSACNSPVLTLTKVEGEERPRDSPGPAEAQAPAGVEAGGRASRRCWTCSRAQLKKIFWGVAVVLCVCSSWAGSTQLAKLTFRKFDAPFTLTWFATNWNFLFFPLYYVGHVCKSTEKQSVKQRYRECCRFFGDNGLTLKVFFTKAAPFGVLWTLTNYLYLHAIKKINTTDVSVLFCCNKAFVFLLSWIVLRDRFMGVRIVAAILAIAGIVMMTYADGFHSHSVIGIALVVASASMSALYKVLFKLLLGSAKFGEAALFLSILGVFNILFITCIPIILYFTKVEYWSSFDDIPWGNLCGFSVLLLTFNIVLNFGIAVTYPTLMSLGIVLSIPVNAVIDHYTSQIVFNGVRVIAIIIIGLGFLLLLLPEEWDVWLIKLLTRLKVRKKEEPAEGAADLSSGPQSKNRRARPSFAR

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes