Purified Membrane Proteins

Stress-associated endoplasmic reticulum protein 2 (Ribosome-associated membrane protein RAMP4-2)

May interact with target proteins during translocation into the lumen of the endoplasmic reticulum. May protect unfolded target proteins against degradation and facilitate correct glycosylation (Potential). {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SERP2_HUMAN

Gene Name:

SERP2 C13orf21

Uniprot Accession:

Q8N6R1

Origin:

Homo sapiens (Human)

Protein family:

RAMP4 family

Full-length:

65

AA

Mass:

7431

Da

MVAKQRIRMANEKHSKNITQRGNVAKTLRPQEEKYPVGPWLLALFVFVVCGSAIFQIIQSIRMGM

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes