Purified Membrane Proteins

Small integral membrane protein 19

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

SMI19_HUMAN

Gene Name:

SMIM19 C8orf40

Uniprot Accession:

Q96E16

Origin:

Homo sapiens (Human)

Protein family:

SMIM19 family

Full-length:

107

AA

Mass:

12439

Da

MAGGYGVMGDDGSIDYTVHEAWNEATNVYLIVILVSFGLFMYAKRNKRRIMRIFSVPPTEETLSEPNFYDTISKIRLRQQLEMYSISRKYDYQQPQNQADSVQLSLE

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes