Purified Membrane Proteins

Olfactory receptor 5B2 (OST073) (Olfactory receptor OR11-240)

Odorant receptor. {ECO:0000305}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

OR5B2_HUMAN

Gene Name:

OR5B2

Uniprot Accession:

Q96R09

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor 1 family

Full-length:

309

AA

Mass:

34568

Da

MENCTEVTKFILLGLTSVPELQIPLFILFTFIYLLTLCGNLGMMLLILMDSCLHTPMYFFLSNLSLVDFGYSSAVTPKVMAGFLRGDKVISYNACAVQMFFFVALATVENYLLASMAYDRYAAVCKPLHYTTTMTASVGACLALGSYVCGFLNASFHIGGIFSLSFCKSNLVHHFFCDVPAVMALSCSDKHTSEVILVFMSSFNIFFVLLVIFISYLFIFITILKMHSAKGHQKALSTCASHFTAVSVFYGTVIFIYLQPSSSHSMDTDKMASVFYAMIIPMLNPVVYSLRNREVQNAFKKVLRRQKFL

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes