Purified Membrane Proteins

Membrane-spanning 4-domains subfamily A member 8 (Four-span transmembrane protein 4) (Membrane-spanning 4-domains subfamily A member 8B)

May be involved in signal transduction as a component of a multimeric receptor complex.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

M4A8_HUMAN

Gene Name:

MS4A8 4SPAN4 MS4A8B

Uniprot Accession:

Q9BY19

Origin:

Homo sapiens (Human)

Protein family:

MS4A family

Full-length:

250

AA

Mass:

26290

Da

MNSMTSAVPVANSVLVVAPHNGYPVTPGIMSHVPLYPNSQPQVHLVPGNPPSLVSNVNGQPVQKALKEGKTLGAIQIIIGLAHIGLGSIMATVLVGEYLSISFYGGFPFWGGLWFIISGSLSVAAENQPYSYCLLSGSLGLNIVSAICSAVGVILFITDLSIPHPYAYPDYYPYAWGVNPGMAISGVLLVFCLLEFGIACASSHFGCQLVCCQSSNVSVIYPNIYAANPVITPEPVTSPPSYSSEIQANK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes