Purified Membrane Proteins

NIPA-like protein 2

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

NPAL2_HUMAN

Gene Name:

NIPAL2 NPAL2

Uniprot Accession:

Q9H841

Origin:

Homo sapiens (Human)

Protein family:

NIPA family

Full-length:

383

AA

Mass:

42156

Da

MAAVAPAGPGDSASAALDELSLNFTYGAPGAGNGSLSGDWYRRNQIHLFGVLLAILGNLVISISLNIQKYSHLQLAQQEHPRPYFKSVLWWGGVLLMAVGETGNFAAYGFAPITLIAPLGCVSVTGSAIISVTFLKDNLRASDLLGTTLAFAGTYLLVNFAPNITQAISARTVQYYLVGWQFLIYVILEILIFCILLYFYKRKGMKHMVILLTLVAILASLTVISVKAVSGMITFSVMDKMQLTYPIFYIMFIIMIASCVFQVKFLNQATKLYNTTTVVPVNHIFFTISAIIAGIIFYQEFLGAPFLTVFIYLFGCFLSFLGVFLVTRNREKEHLQQSYIDFGNIPGKQMLDKIQPDSHSLSYGTLPDGSDSTKSQSGEKKEV

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes