Purified Membrane Proteins

Zinc transporter ZIP9 (Solute carrier family 39 member 9) (Zrt- and Irt-like protein 9) (ZIP-9)

May act as a zinc-influx transporter. {ECO:0000250}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

S39A9_HUMAN

Gene Name:

SLC39A9 ZIP9 UNQ714/PRO1377

Uniprot Accession:

Q9NUM3

Origin:

Homo sapiens (Human)

Protein family:

ZIP transporter (TC 2.A.5) family

Full-length:

307

AA

Mass:

32251

Da

MDDFISISLLSLAMLVGCYVAGIIPLAVNFSEERLKLVTVLGAGLLCGTALAVIVPEGVHALYEDILEGKHHQASETHNVIASDKAAEKSVVHEHEHSHDHTQLHAYIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHAAADGVALGAAASTSQTSVQLIVFVAIMLHKAPAAFGLVSFLMHAGLERNRIRKHLLVFALAAPVMSMVTYLGLSKSSKEALSEVNATGVAMLFSAGTFLYVATVHVLPEVGGIGHSHKPDATGGRGLSRLEVAALVLGCLIPLILSVGHQH

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes