Purified Membrane Proteins

Transmembrane protein 242

Scaffold protein that participates in the c-ring assembly of mitochondrial ATP synthase (F(1)F(0) ATP synthase or complex V) by facilitating the membrane insertion and oligomer formation of the subunit c/ATP5MC3 (PubMed:33753518). Participates in the incorporation of the c-ring into vestigial complexes (PubMed:33753518). Additionally influences the incorporation of subunits MT-ATP6, MT-ATP8, ATP5MJ, and ATP5MK in the ATP synthase (PubMed:33753518). {ECO:0000269|PubMed:33753518}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM242_HUMAN

Gene Name:

TMEM242 C6orf35 BM-033 HSPC287

Uniprot Accession:

Q9NWH2

Origin:

Homo sapiens (Human)

Protein family:

TMEM242 family

Full-length:

141

AA

Mass:

14758

Da

METAGAATGQPASGLEAPGSTNDRLFLVKGGIFLGTVAAAGMLAGFITTLSLAKKKSPEWFNKGSMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMNDFRSKMQSIFPTIPKNSESAVEWEETLKSK

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes