Purified Membrane Proteins

Taste receptor type 2 member 10 (T2R10) (Taste receptor family B member 2) (TRB2)

Gustducin-coupled strychnine receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. {ECO:0000269|PubMed:15759003}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

T2R10_HUMAN

Gene Name:

TAS2R10

Uniprot Accession:

Q9NYW0

Origin:

Homo sapiens (Human)

Protein family:

G-protein coupled receptor T2R family

Full-length:

307

AA

Mass:

35365

Da

MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIIITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYFIGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEKRKNLRVT

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes