Purified Membrane Proteins

Neuron-specific vesicular protein calcyon

Interacts with clathrin light chain A and stimulates clathrin self-assembly and clathrin-mediated endocytosis. {ECO:0000269|PubMed:16595675}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

CALY_HUMAN

Gene Name:

CALY DRD1IP

Uniprot Accession:

Q9NYX4

Origin:

Homo sapiens (Human)

Protein family:

NSG family

Full-length:

217

AA

Mass:

23434

Da

MVKLGCSFSGKPGKDPGDQDGAAMDSVPLISPLDISQLQPPLPDQVVIKTQTEYQLSSPDQQNFPDLEGQRLNCSHPEEGRRLPTARMIAFAMALLGCVLIMYKAIWYDQFTCPDGFLLRHKICTPLTLEMYYTEMDPERHRSILAAIGAYPLSRKHGTETPAAWGDGYRAAKEERKGPTQAGAAAAATEPPGKPSAKAEKEAARKAAGSAAPPPAQ

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes