Purified Membrane Proteins

Transmembrane protein 216

Part of the tectonic-like complex which is required for tissue-specific ciliogenesis and may regulate ciliary membrane composition. {ECO:0000269|PubMed:22282472}.

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

TM216_HUMAN

Gene Name:

TMEM216 HSPC244

Uniprot Accession:

Q9P0N5

Origin:

Homo sapiens (Human)

Protein family:

nd

Full-length:

145

AA

Mass:

16487

Da

MLPRGLKMAPRGKRLSSTPLEILFFLNGWYNATYFLLELFIFLYKGVLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLSISVALTFPSAMMASYYLLLQTYVLRLEAIMNGILLFFCGSELLLEVLTLAAFSRI

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes