Purified Membrane Proteins

LHFPL tetraspan subfamily member 6 protein (Lipoma HMGIC fusion partner)

Native

Stable

Pure

Active protein

Recombinant protein

Human Origin

Entry Name:

LHPL6_HUMAN

Gene Name:

LHFPL6 LHFP

Uniprot Accession:

Q9Y693

Origin:

Homo sapiens (Human)

Protein family:

LHFP family

Full-length:

200

AA

Mass:

21598

Da

MASSLTCTGVIWALLSFLCAATSCVGFFMPYWLWGSQLGKPVSFGTFRRCSYPVHDESRQMMVMVEECGRYASFQGIPSAEWRICTIVTGLGCGLLLLVALTALMGCCVSDLISRTVGRVAGGIQFLGGLLIGAGCALYPLGWDSEEVRQTCGYTSGQFDLGKCEIGWAYYCTGAGATAAMLLCTWLACFSGKKQKHYPY

CALIXAR fits your needs

Expression systems: bacteria, yeast, insect cells, HEK & CHO mammalian cells
Purified formats: detergents, SMALPs, nanodiscs, proteoliposomes